99
|
Ocean Optics
usb2000 Usb2000, supplied by Ocean Optics, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/usb2000/product/Ocean Optics Average 99 stars, based on 1 article reviews
usb2000 - by Bioz Stars,
2026-03
99/100 stars
|
Buy from Supplier |
90
|
Verlag GmbH
ag267-xaux(sr)80 Ag267 Xaux(Sr)80, supplied by Verlag GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ag267-xaux(sr)80/product/Verlag GmbH Average 90 stars, based on 1 article reviews
ag267-xaux(sr)80 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
S D Fine-Chem
xanthan gum 80 mesh sr-2 Xanthan Gum 80 Mesh Sr 2, supplied by S D Fine-Chem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/xanthan gum 80 mesh sr-2/product/S D Fine-Chem Average 90 stars, based on 1 article reviews
xanthan gum 80 mesh sr-2 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
N/A
|
Recombinant Rat NTSR2 full length or partial length protein was expressed http www creativebiomart net Recombinant Rat NTSR2 Protein 452929 htm
|
Buy from Supplier |
N/A
|
The NTS2/NTSR2 Antibody [DyLight 680] from Novus is a NTS2/NTSR2 antibody to NTS2/NTSR2. This antibody reacts with Human, Mouse. The NTS2/NTSR2 antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
|
Buy from Supplier |
N/A
|
Recombinant Chicken PNISR full length or partial length protein was expressed http www creativebiomart net description 416136 12 htm
|
Buy from Supplier |
N/A
|
SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA. Rabbit polyclonal SSR2 antibody.
|
Buy from Supplier |
N/A
|
Recombinant Zebrafish ESR2A full length or partial length protein was expressed http www creativebiomart net description 429780 12 htm
|
Buy from Supplier |
N/A
|
Recombinant Zebrafish ESR2B full length or partial length protein was expressed http www creativebiomart net description 429734 12 htm
|
Buy from Supplier |
N/A
|
The SSR2 Antibody (31G6) [DyLight 680] from Novus is a SSR2 antibody to SSR2. This antibody reacts with Human. The SSR2 antibody has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence.
|
Buy from Supplier |
N/A
|
The Recombinant Human CELSR2 Protein has been validated for the following applications Western Blot ELISA Protein Array Immunoaffinity Purification
|
Buy from Supplier |
N/A
|
Recombinant Rhesus monkey SSR2 full length or partial length protein was expressed http www creativebiomart net Recombinant Rhesus monkey SSR2 Protein His tagged 461139 htm
|
Buy from Supplier |