software originpro 8.0 sr2 Search Results


99
Ocean Optics usb2000
Usb2000, supplied by Ocean Optics, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/usb2000/product/Ocean Optics
Average 99 stars, based on 1 article reviews
usb2000 - by Bioz Stars, 2026-03
99/100 stars
  Buy from Supplier

90
Verlag GmbH ag267-xaux(sr)80
Ag267 Xaux(Sr)80, supplied by Verlag GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ag267-xaux(sr)80/product/Verlag GmbH
Average 90 stars, based on 1 article reviews
ag267-xaux(sr)80 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
S D Fine-Chem xanthan gum 80 mesh sr-2
Xanthan Gum 80 Mesh Sr 2, supplied by S D Fine-Chem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/xanthan gum 80 mesh sr-2/product/S D Fine-Chem
Average 90 stars, based on 1 article reviews
xanthan gum 80 mesh sr-2 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

N/A
Recombinant Rat NTSR2 full length or partial length protein was expressed http www creativebiomart net Recombinant Rat NTSR2 Protein 452929 htm
  Buy from Supplier

N/A
The NTS2/NTSR2 Antibody [DyLight 680] from Novus is a NTS2/NTSR2 antibody to NTS2/NTSR2. This antibody reacts with Human, Mouse. The NTS2/NTSR2 antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
  Buy from Supplier

N/A
Recombinant Chicken PNISR full length or partial length protein was expressed http www creativebiomart net description 416136 12 htm
  Buy from Supplier

N/A
SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA. Rabbit polyclonal SSR2 antibody.
  Buy from Supplier

N/A
Recombinant Zebrafish ESR2A full length or partial length protein was expressed http www creativebiomart net description 429780 12 htm
  Buy from Supplier

N/A
Recombinant Zebrafish ESR2B full length or partial length protein was expressed http www creativebiomart net description 429734 12 htm
  Buy from Supplier

N/A
The SSR2 Antibody (31G6) [DyLight 680] from Novus is a SSR2 antibody to SSR2. This antibody reacts with Human. The SSR2 antibody has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence.
  Buy from Supplier

N/A
The Recombinant Human CELSR2 Protein has been validated for the following applications Western Blot ELISA Protein Array Immunoaffinity Purification
  Buy from Supplier

N/A
Recombinant Rhesus monkey SSR2 full length or partial length protein was expressed http www creativebiomart net Recombinant Rhesus monkey SSR2 Protein His tagged 461139 htm
  Buy from Supplier

Image Search Results